SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|549720014|ref|YP_008642647.1| from Vibrio nigripulchritudo VibrioScope

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|549720014|ref|YP_008642647.1|
Domain Number 1 Region: 7-154
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.4e-24
Family Glutathione peroxidase-like 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|549720014|ref|YP_008642647.1|
Sequence length 178
Comment putative Thiol-disulfide isomerase and thioredoxin [Vibrio nigripulchritudo]
Sequence
MNTLPIAPEWKTSAWLNADVPITLKDLRGKVVVLHTFQMLCPGCVSHGLPQASKIHKVFR
DDDVEVIGLHTVFEHHQAMQLDSLKAFIHEYRLSFPIAVDAPSGGDIPLTMAEYGLPGTP
TLILIDKSGQLRFSHHGIIDDMVVAKMITDLLHEEFSPVTPQATDPFSHCDDEKCSTG
Download sequence
Identical sequences U4KJ07
WP_022562003.1.100974 WP_022562003.1.41471 WP_022562003.1.79392 WP_022562003.1.83433 WP_022562003.1.85604 WP_022562003.1.99411 gi|549720014|ref|YP_008642647.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]