SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|549720171|ref|YP_008642804.1| from Vibrio nigripulchritudo VibrioScope

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|549720171|ref|YP_008642804.1|
Domain Number 1 Region: 21-196
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.53e-21
Family DsbA-like 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|549720171|ref|YP_008642804.1|
Sequence length 205
Comment putative disulfide isomerase/thiol disulfide oxidoreductase dsbA [Vibrio nigripulchritudo]
Sequence
MKSLLLTLLILCGANSVAAYELKEGLDYDVVPQQIMVDNTVKVYFSFRCGHCAAFDSVYY
QVSQHLPDQVCLTKIPLFNPQDELDLLYAKSFAVAQQNGVEFQYTREMFEALKNRQAPKC
VKTMTQFFAKSLNIKPSLFKTHFEAKETENKLAGYLLDAERLEVKAVPTVIVGNTYHVTP
KRVTSFEEYKVLIQKVVNQHIKRPA
Download sequence
Identical sequences U4KJ39
gi|549720171|ref|YP_008642804.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]