SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|118477238|ref|YP_894389.1| from Bacillus thuringiensis str. Al Hakam

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118477238|ref|YP_894389.1|
Domain Number 1 Region: 26-112
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.87e-18
Family GntR-like transcriptional regulators 0.037
Further Details:      
 
Domain Number 2 Region: 99-232
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 2.2e-17
Family GntR ligand-binding domain-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|118477238|ref|YP_894389.1|
Sequence length 239
Comment GntR family transcriptional regulator [Bacillus thuringiensis str. Al Hakam]
Sequence
MFMRKRKIYNERIEFTMPIPQNYKKQGRVSAKSLVLNQLQDWIIEGVLKPDEKINDGELA
EALGVSRTPVREALQILELSGLVEMVPGQKTKIAPIKLDDIPTIYETMAGLHSIIGKQAL
QHTTEADLKLLSEINNDFQYSIEKKNAKQALELDIQFHNAISSIAKNQYIEPFLENMQLH
VLRLEYLFFQNFVPASQSIDEHHAIIQALQKQDEKQMEQMMTQNWLRPMKEIQKIISTK
Download sequence
Identical sequences A0RCD9
gi|118477238|ref|YP_894389.1| 412694.BALH_1544

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]