SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|148272875|ref|YP_001222436.1| from Clavibacter michiganensis subsp. michiganensis NCPPB 382

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148272875|ref|YP_001222436.1|
Domain Number 1 Region: 9-275
Classification Level Classification E-value
Superfamily Cgl1923-like 3.92e-74
Family Cgl1923-like 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|148272875|ref|YP_001222436.1|
Sequence length 319
Comment hypothetical protein CMM_1693 [Clavibacter michiganensis subsp. michiganensis NCPPB 382]
Sequence
MADAERFVSGRLLVVAFEGWNDAGEAASGAVRALKDLLDLEAVSSVDPEDYFDFQFNRPT
IGFAEDGTRELEWPGATLYGPKDPRRPAQDLAADAQLGVSGDNGGSIHLLLGVEPSRHWT
AFTAEVLDAARAAGVEGVVLLGALLADVPHTRPISVYSTSENASVRAELGIERSTYEGPV
GILSIIAQRAEEMGMPTVSLWASVPHYVHSAPSPKATLALIDKLEEMVDVVIPRGELIQE
AATWEAGIDQLAGEDEDMASYIQQLEQARDTVDSPEASGEAIAQEFEKYLRRGDGPRGRG
DDRPEEPWRPKDPKDPKDQ
Download sequence
Identical sequences A0A1Y3FG88 A5CRN6
443906.CMM_1693 WP_012038381.1.100120 WP_012038381.1.11755 WP_012038381.1.36461 WP_012038381.1.56944 WP_012038381.1.75151 WP_012038381.1.80587 WP_012038381.1.8140 WP_012038381.1.84123 WP_012038381.1.88496 WP_012038381.1.97611 gi|148272875|ref|YP_001222436.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]