SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|148273228|ref|YP_001222789.1| from Clavibacter michiganensis subsp. michiganensis NCPPB 382

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148273228|ref|YP_001222789.1|
Domain Number 1 Region: 332-503
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.09e-42
Family Ribonuclease PH domain 1-like 0.000000591
Further Details:      
 
Domain Number 2 Region: 9-152
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.57e-41
Family Ribonuclease PH domain 1-like 0.00000074
Further Details:      
 
Domain Number 3 Region: 153-265
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.14e-25
Family Ribonuclease PH domain 2-like 0.0000171
Further Details:      
 
Domain Number 4 Region: 485-584
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.32e-22
Family Ribonuclease PH domain 2-like 0.0000256
Further Details:      
 
Domain Number 5 Region: 589-699
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.33e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0038
Further Details:      
 
Domain Number 6 Region: 271-356
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.00000000000000628
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|148273228|ref|YP_001222789.1|
Sequence length 757
Comment polynucleotide phosphorylase/polyadenylase [Clavibacter michiganensis subsp. michiganensis NCPPB 382]
Sequence
MEGPEIKFAEAVLDNGKYGTRTVRFEAGRLAQQAQGAVAAYLDEDTMLLSATSVGKHPKD
NFDFFPLTIDVEERSYAAGKIPGSFFRREGRPSTEAILVCRLIDRPLRPSFITGLRNEVQ
VVITVLSIAPDEFYDSLAINAASASSMLSGIPFSGPIAGVRLALIGDQWVVFPKHSQLKE
AVFDITVAGRVVTDSEGNEDVAIMMVEAEATEGAWDLIQGGATKPDEAIVAQGLEAAKPF
IQQLVAAQASLAQQAAKPTVDYPVFLPYAQETYDAVSALALDELGTVYQTADKIERQDAD
DALKTRTKEAVAAKVEAGELPQSALTEFSAAYKSVTKTVVRGRILRDGVRMDGRGLADIR
PLDAEVQVIPRVHGSAIFQRGETQILGVTTLNMLKMEQQIDSLSPITKKRYLHHYNFPPY
STGETGRVGSPKRREIGHGFLAERALVPVLPSREDFPYAIRQVSEALGSNGSTSMGSVCA
STLSLLNAGVPLRAPVAGIAMGLVSDTVDGQVRYAALTDILGAEDALGDMDFKVAGTSEF
VTAIQLDTKLDGIPTSVLDGALKQAKEARTAILGVLNQAIDGPDEMAPTAPRVISVNIPV
DKIGELIGPKGKTINAIQDETGADISIEEDGTVYIGAVDGPSADAARAQVNAIANPTNPE
VGESFLGTVVKIATFGAFVSLLPGKDGLLHISEVRKLAGGKRVENVEDVLGVGQKILVEI
TKIDDRGKLSLAPVLEETADQEGRDAASHGSEAPAEG
Download sequence
Identical sequences A0A1Y3FEZ5 A5CSN9
gi|148273228|ref|YP_001222789.1| WP_012038734.1.100120 WP_012038734.1.36461 WP_012038734.1.56944 WP_012038734.1.75151 WP_012038734.1.80587 WP_012038734.1.8140 WP_012038734.1.84123 WP_012038734.1.88496 443906.CMM_2047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]