SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|117618727|ref|YP_855898.1| from Aeromonas hydrophila subsp. hydrophila ATCC 7966

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|117618727|ref|YP_855898.1|
Domain Number 1 Region: 3080-3346
Classification Level Classification E-value
Superfamily PMT central region-like 9.68e-95
Family PMT central region-like 0.0002
Further Details:      
 
Domain Number 2 Region: 3348-3569
Classification Level Classification E-value
Superfamily EreA/ChaN-like 1.78e-73
Family PMT domain-like 0.0021
Further Details:      
 
Domain Number 3 Region: 2450-2625
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 6.62e-23
Family Atu1826-like 0.021
Further Details:      
 
Domain Number 4 Region: 4409-4600
Classification Level Classification E-value
Superfamily beta-Roll 0.0000000000000101
Family Serralysin-like metalloprotease, C-terminal domain 0.0017
Further Details:      
 
Domain Number 5 Region: 4325-4445
Classification Level Classification E-value
Superfamily beta-Roll 0.00000432
Family Serralysin-like metalloprotease, C-terminal domain 0.0033
Further Details:      
 
Domain Number 6 Region: 1434-1573
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000578
Family Family 28 carbohydrate binding module, CBM28 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|117618727|ref|YP_855898.1|
Sequence length 4685
Comment structural toxin protein RtxA [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
Sequence
MGKSVWRSIEYFFTGNYTADDGNNDIDAYGLGGVIHAYGGDDTIRVGSIGATVYTGTGND
SVYGGAAYLKVVDDSGNLTVKGAAGYADISKSQSGNVHFAGASGATNIDHQGRDGDIRYQ
GAALANFLTRKGISGNVSFEGAGGYNKLWHQTDRGDLSYSGAGAANKLDRTWHSQYQGSQ
GNIHFAGAGAANIISSQVESGNVTLNGAGAYNKVFRKGREGDVNFNGAGGWNELSRLRNE
QDEYLQTRGDIRFNGAGGYNRLLSDVAEGNIHFKGAGGYNHLSRKGADSDSSPFAGARAD
EIALTTATMGGSWINQSQPVTAIKSSLQPNTYLFAFFDGMYTKVNRVELSNDGANGALRY
HATSWYKEGNHLDGLAGRQIDAGNGFVSTQTDGAYRLSDLVFERRQRIKLEAVEADLTEN
SWINYGGGVNVAAADVTLSSAKMSGYAIFEDGTKVDVNAVKSRAQANTYVFAKQLGPYTK
IVVVELANDRETGALKYLAKAWYKEGNHLAGLADKVISEHTGFTAMGTGGYSLSEVRYQL
DTVTAVSDRLPATREFSSQSLLPRQQSGGKSKGDIFFDGAGGGNVIESDVTEGNIHFNGA
GAANVLIKRGQRGDLVFRGAGLANVLVHQGAQGRMDVYAAGAANVLVRSGDGEYLARLLA
YGNISVQQGRGDSQVVMLGGYNTHTQLGDGHGLWLAGGGFNLLTQVGNGRLDALSVGGAN
VLTKLGAGQLTAGLLGGANVLTHVTQGEEAADTRAVLLGGANVLTKKGNGKVQAILGGGA
NVLTQIGQGDTQALLLGAANVLTRVGDGDLSAVMLGGANVLTHVGNGDTLGVMGAAGNLF
TKVGDGTAIAAMIGAGNLFTQIGQGDAWALMGGVANIFTKVGDGNALALMVAKANVFTHI
GDGLTVALMLAQGNLATKVGNGMTLAAMVGNANVFTHVGAGETFAAMLGQANLFTKVGDG
LTAALMIGKANVYSHIGNGTSLGLFAGELNVMTKVGNGTTLAALFGKANIVTHVGGGLTG
VLALGKANIITKVGDDFLGAIAKADANVLTHVGNGTTAGVLWGKGNLLTKIGDGTTVGLL
ISEVGNVMTHVGAGSTIGLAKGRANLITKVGDGLVVQGAWGDVNLLTQVGNGDRYSFAKG
RANVLTKVGDGREVAVLQGEANLVTQVGNGDGYTGAWGKANVITKVGDGRQVVLAKGDAN
IVTQVGEGDGYQALLGKANIVTRVGDGIQVTLAKGEVNQTTTVGDGLSVTAAYGKFNNNV
KVGDGTTINLAWGDYNLNTKVGDGLNVAVMKGKGNANVQIGDGLDITAAYARHNVAIKIG
NGDFYSLAIASSNTSSNKLGTLFDNIKQTLLGSAGNQAINYLVQGDEEGPLKAPQAASLG
EVQGLSGFGLDEIGEVKSSLAGSLTGKVSQAGEHDEQAMDKALQLDEQGLARGGENLIVN
GDFERGAQGWQHAGAGIEADFSAATYGLAADGHGARVSELSTDRNTQISQDLAGLKAGET
VNLTFDFARRANISLQHGIEVLWNGERVFASEGDASSWQSKALTLTASEGRNTLAFRGIG
ESNGLGYLLDNVVATASGKAEIGQVSAQLAQDDNAARARGDQASADADKQRLEQEKGQQL
AAIAGTQAQLEATDQHKLAQNGQDQRAAIEAESREMTAQLDTLARRFEQVRASDAASEPS
GQHWRTGFADRLLSTVQEDLDDAGNTAGTAIEEGRSRHEAQHQQLDTALAKSKTGQQRSE
QQQGNAEAAGQHRAAQAEQRRLDALARQGEATSRQQQGEASASQAQLAGEQAASQAGLQA
NQAKQNAASLKQSGDKPTRQGVQSGPSTAAGQPLLQTGELDVPAVSTLSAPDEVPSSAID
TATGLSEQEQSALDGALAAVNRLQINAGSRQPVAPTPTPTPTEVQQEAQATATVTKPAQQ
HEVLAKAAVDLTGLHGPRPGSKAVPEFSSHFDGSSIGIENELTGLVVALPKNSAQKFGYV
HDAAGNPLFMLTKDMNQGGYTNPAGISDVKGINQWQTHTIELVTYPSEMQDQQAVEARKE
AMLWLAREFTQHISQTNHTRLSDLVSEDGRFTLVISNANHVIAAGNGAARDGQGQTIGMT
PSGQQATVAVSAKAFGSGSSQEIRLLESAPWYHPELKDLLLSNMANVQWEDAATAQNVFA
YLTSIYGKTADLAREYGIHINDWDPLAEGITPNAQGLTDPKVKNAWEILPRTKPVAMLAL
LSAHDRKLVSEQILATLKSAYSPALAQNIYDYFKFGGEVAGHGINNATTGDSKHPEPAIL
FEFRQVPNELSQFVPKSESTARVEVKTLDQFDPVSRRTIVAAVNNLVEQSADFDSWYQAY
RERQGLPPVKNAKKVASANHKAEWVMANHAEAWSQLTAEHQAQDASGLQALGGHKPGDQS
PGVANADTVPLDKQPLNPLTRFLNDNLYGTRDERRQVGDITRQLLDHAVSKGEAEQVTLQ
GDAGRLSGYLHKGAERPGTPQDGKPEVVLFLHGSGSSAEEQADAVRSHYQKQGIDMLAVN
LRGYGTSDGGPSEQGVYQDARTMFRYLVEERGVAPDKILIHGYSMGGPIAADLARYAAEQ
GKPVGGLLLDRPMPSMSKAITAHELPNPGGLVGALAKAINGRFSVEKNLDGLPKSTPIML
LTDNEGLGREGEKLRAKLAVAGYQVSGEQTFYGHLASNRLMGQYAEQIVDDLFNRTPSAA
DIEAPLKGIEAIRRDLKRYQEALTPQVGSNGATRDIRTTKAFLAGYQQGLAGKVVEGFQP
DMSMTQLVDLFVQPTLSPQQQGALAWEIENRALKSTIKPRIEQSNRLFRDVASQGGTDPY
AREHLAPQLLLLNLADDGFGGRCDPLSKLVLVAKQLESEGQPDLARRMMEKLYSAAAVIN
NPDRYSATELDNARKLVGSLAEIHTNTPAAYNYDSLRSIKYDIVKEKWEGKNAISLGTVL
TKLTAKGSDAPVLMELDAPGHAMAAWAKQGESGRIYGFYDPNAGIVEFSSAEKFSRYMTG
FFGKEGLDMANGYHLKPGPDGKPLFFRVSEMNGAELARFKPSKDLANKVTLQEILQLPVF
DESPMAELPGKTVVTERTAKLFADVYSPDELKKAAQVFAKPIGESYQQILDQLATLHGAS
GQTKIEAALRLNNLIDDYLVKYEGSGRNPALSKLQSQLHGNLYRGELASLQTEVTALAKT
RPDLAAIVIGKAAEEAQGQHPGLTQMVLRWAAQDPYLAAKAGYQGGVPADLPFDARFHIA
LGEHHGDLKKWLTEAQGKGLLSRAVLDDTRKLLHLGYSYQELQDMTGEQSAQMAVYFIKE
AAKQAAPGSDLSAEHIMLDKFGDRRYLGELESRRIEQIENIYHSSKQTDVAAWDARYGSD
ALRTLNAQLDGDSTLAGQLARLLDNRNGLLIGETHGSDVNGLRFVNEQMDALKAQGVTVI
GLEHLRGELAQPLIDRYLAGGEMSPELATMLKSKHLEPSLFERARERGLRIVALDDGSTA
RPVIGGTEHGLMYRAGAANNVAVDVLGKLPAGEKFVAIYGSAHLASHKGIEGFVPGITHR
LGLPALKVDADNRFHLQGDDVSQRVEYADVGRKWTPPAALDGADQPVRNQRVEQWQRPEV
VPGSEGGETRFTSQVIIQTEDDPVAAKAAASLAGKHPDRSLVVQLDADGNYRVVYGDPAQ
LAGNIRWQVVGHGRDADGQNNSRLSGYSADELAGHLRRLGDRLQQEAGVTTKPSHISLVG
CSLVSDDLQTGFARRFIQALDNEGIRTQVSARSSEVAVDQGGRKHTRNEADVWARKVAAN
KVVLTLDDAGEPVVHNERVRGGVAEGDIVLAKVGEGESRARGAIADNDETFVAPDKQRQP
ETASSHADNAVSYSGNIQVNVGDGEFTALNWGTTNLGVKVGTGGMKSLAFGDNNVMVHIG
DGDSKHSVDIAGYRALEGAQLFVGQRNVSFNLGRSNDLIVMLEKSIPTPPLVNPFGGAAR
IAGALQQIAGDGAKPDWVASQWDQWTLAGANKFVADMAGLDQTSSVEYGSLTRLDSDHER
SSRGLKSDLEATLNKEFNKRISGGGQGEQGPLSRADKLRQANEKLVFNFAVAGQGADIQV
TTGNWNFVFGDNIQAILDTNLGSLFGLMTQEFTASGQAKTTFTFTPTDLPRQLQNRLLGR
LAGVGADTTLADIFGVDYNARGQLVARDGAAIDAPALLQEMLGVIAEFGGDQLKSLTDPA
KWLDQLKAGLDLGEDALSSFARSHGLQDEAPEEAKSGTVTVQQGNDAKPAALPAATEERA
FGFNALSLPNLFATLFNRDKQAEVVALASNLKQNLTADLLNMKEQTFDFLRNSGHLQGDG
DMHVSLGNYNFNWGGDGKDLGAYLGDNNNFWGGRGDDVFYATGTSNIFTGGAGQDTGIMM
GRENMMFGGQGDDVAVLAGRVNRAFMGEGNDQAFIFGEEGIVEGGAGQDYLVTSGNYNQI
DAGSDQDFTVTIGHHNQIRLGEGDDFAMVFGNHNRLLAEHGNNQVKLMGYHATIRGGDGQ
DRLIADQVAKFSQLDGGAGDDLLVLGGYQNQFSGGTGVDSFVFSGAVIKNLVQDIGKEDF
IVFNDVSWRDLWFKRSGYDLQLLVNRHTDGTSEQGKFEQLGSATFSNYFADNRAQLVIGL
GEQQADGERSYSALSHQAVDKLIQAMSSFAPEAGDMGLLNRLDSQANSLVQSAWGDVIQG
KGRVA
Download sequence
Identical sequences A0KHZ7
gi|117618727|ref|YP_855898.1| 380703.AHA_1359 WP_011705266.1.12787 YP_855898.1.44769

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]