SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|119872514|ref|YP_930521.1| from Pyrobaculum islandicum DSM 4184

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|119872514|ref|YP_930521.1|
Domain Number - Region: 7-39
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 0.000392
Family RecO C-terminal domain-like 0.079
Further Details:      
 
Domain Number - Region: 27-66
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0182
Family Classic zinc finger, C2H2 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|119872514|ref|YP_930521.1|
Sequence length 82
Comment hypothetical protein Pisl_1004 [Pyrobaculum islandicum DSM 4184]
Sequence
MRYLRLSVPYCAVCGREVNFKNVAYIRENIFVCKDCFPQYYIKNLCRVVERRLRGENPLA
CNFCTFKKQCDNYVAKTVKSLS
Download sequence
Identical sequences A1RT96
384616.Pisl_1004 gi|119872514|ref|YP_930521.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]