SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|119872610|ref|YP_930617.1| from Pyrobaculum islandicum DSM 4184

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119872610|ref|YP_930617.1|
Domain Number 1 Region: 60-148
Classification Level Classification E-value
Superfamily SMAD/FHA domain 2.87e-18
Family FHA domain 0.0017
Further Details:      
 
Weak hits

Sequence:  gi|119872610|ref|YP_930617.1|
Domain Number - Region: 3-29
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.000589
Family Ran binding protein zinc finger-like 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|119872610|ref|YP_930617.1|
Sequence length 152
Comment FHA domain-containing protein [Pyrobaculum islandicum DSM 4184]
Sequence
MPWKCPVCGTINRDEDLVCRICGAYKPEATTKKISQTPRESIAAVAIVEVLESPIESLIG
RKFEFKINTPGAIITVGRAVENQVVIPDPAVSRRHMRLIVTSNGVVVEDLGSSNGTYIIE
GNNERLIKVENVGRQAVLKIGNTKLRIYLTHR
Download sequence
Identical sequences A1RTJ2
WP_011762849.1.84334 gi|119872610|ref|YP_930617.1| 384616.Pisl_1103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]