SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110638444|ref|YP_678653.1| from Cytophaga hutchinsonii ATCC 33406

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110638444|ref|YP_678653.1|
Domain Number 1 Region: 56-274
Classification Level Classification E-value
Superfamily L domain-like 1.63e-24
Family Internalin LRR domain 0.062
Further Details:      
 
Domain Number 2 Region: 280-353
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000188
Family I set domains 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|110638444|ref|YP_678653.1|
Sequence length 528
Comment glycoprotein [Cytophaga hutchinsonii ATCC 33406]
Sequence
MRILLTSFFFLAIRVAFSQLLTLQDDHLRDKLILSYPQVMQGNALDISKASLLTNVLDLR
GAGITNAAGIEYFKSITTLDLSNNQLTSVPNISGITGLVNFYASNNKLTSLPNMATLHLK
DFQVVNNMLTALPDLSGSTGLLSLYCSNNNLIEFPPLTQFPQLSKLVSGQNPISASFIDV
TPCIHLTELHVHKTGIDTIIGLEKLTGLTTLYAWTNNIKSFKSLDLISTLTICIIYDNPF
SDMPYLQNKSALNRLNVNGALLTFEDIKPVLQNPPATFIYSPQREIFFADVTARAENNYT
LTYPVTAPLSSNIYVWFKNGIVIDSSASPSYTFSPLKNADAGNYQLKIYNTSVSLLTLNT
NTFKITVQPCIELNIINADVVSKDCSKGYTIDFSQNQISGGTPPFTYELATSSTRKNISY
PLVENVEAGNYFLKVVDSRLCSATNNFVLNKIDNCDPVMTPNGDGITDTYYIEKTGKVTV
YNLQRVVVNTLQAPIVWDGTDRNGALLDAGFYILIMDGEKPVYLTIIR
Download sequence
Identical sequences Q11TF3
WP_011585428.1.19587 WP_011585428.1.79486 gi|110638444|ref|YP_678653.1| 269798.CHU_2048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]