SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256370893|ref|YP_003108717.1| from Acidimicrobium ferrooxidans DSM 10331

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256370893|ref|YP_003108717.1|
Domain Number 1 Region: 44-173
Classification Level Classification E-value
Superfamily Sortase 0.00000000000000353
Family Sortase 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|256370893|ref|YP_003108717.1|
Sequence length 320
Comment peptidase C60 sortase A and B [Acidimicrobium ferrooxidans DSM 10331]
Sequence
MASLGFVLAGLGTAGIVWPVTWLQHAEARGTVSIRRVVRSECDAVPAGAIGVLAIPSVGV
VAPVAQGLAQATLAWAVGHDPSTPLPGELGVSVLAAHDVSYFASNATLRRGAAVLYAQGC
RTYVFTVADRLVLHPGQLIPPPGPRGLALDSCWPSDALFLTPDRLIVTARLVAITRGDRL
TLASTGVTPSLPAGVPQPPNLFASGWLGGTLTILGAASVRWRDSRAPMAWEAEALASLSA
ARVGLAQDARWTSLVVAAGTVRTGLLLAPYTSGTPVSVREVVLGDRVLSVAVTVTLGGNP
LTVTEVPSAGTLRIVSVDPV
Download sequence
Identical sequences C7M1J5
525909.Afer_0073 gi|256370893|ref|YP_003108717.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]