SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256371373|ref|YP_003109197.1| from Acidimicrobium ferrooxidans DSM 10331

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256371373|ref|YP_003109197.1|
Domain Number 1 Region: 55-180,457-537,588-599
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.00000000183
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.02
Further Details:      
 
Weak hits

Sequence:  gi|256371373|ref|YP_003109197.1|
Domain Number - Region: 296-421
Classification Level Classification E-value
Superfamily Fucose-specific lectin 0.0418
Family Fucose-specific lectin 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|256371373|ref|YP_003109197.1|
Sequence length 603
Comment hypothetical protein Afer_0570 [Acidimicrobium ferrooxidans DSM 10331]
Sequence
MGRTSRSWPRKEILPLLALSLALAGCGAIASRPAVASKTTATKAVEQLPLDILQSSITAT
GTVYLASTSATGGNPVLLRYRDGAFSYLARLPGPDPLLDVLDRNDGFVASLQSGDLYAMV
DQGTRFRLLHHFSSGPTIIGVGFVTPARGYVVLSAAQGTTVEATTDGGRTWHLLETLALR
YPGTAASFDFGRQSSYLLVTSPSQGETAYFAQTQGSATFQAISSPGPQLDGVFPDSLQVV
GSSLVVGFQPTPGANFPASPPLLATTPTPSFVSNQPHWFMTHGVEFDNFRTLSNGSVVAV
SERGIYRYSPGTGWTRSFPDVMVSSLFNAQGSLGIVGVGPSGQLEVLVGSTRWSSPALSK
LLASPNAHVIGTTARQRALVIAVQTPEGVLQLVTVDRAGERPSLMVPSSIANAVAAVVAN
GTGVALETTAATGFGAGATYLSPITDPIRPTALHHTGSTIPLAIDPLSAQSVWIGSTRPL
GATAATGAPPSDDVLAYTSNDGNSWTNLSVGANDIDAIDYASPTTVWATLSPYATPSFSF
LVRVHRTTGSVERVPIPSLLHQGFSAVFVSPTTGWLQSLDCHDGCSTLLHTTDGGRHWQL
TAP
Download sequence
Identical sequences C7M3D0
525909.Afer_0570 gi|256371373|ref|YP_003109197.1| WP_015798019.1.72805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]