SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256372101|ref|YP_003109925.1| from Acidimicrobium ferrooxidans DSM 10331

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256372101|ref|YP_003109925.1|
Domain Number 1 Region: 119-242
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 6.28e-22
Family GntR ligand-binding domain-like 0.0083
Further Details:      
 
Domain Number 2 Region: 25-112
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.82e-21
Family GntR-like transcriptional regulators 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|256372101|ref|YP_003109925.1|
Sequence length 264
Comment GntR family transcriptional regulator [Acidimicrobium ferrooxidans DSM 10331]
Sequence
MGREHQGAVPPIADVRGHLDLSRILRPQSAPDQIADRILAAIAVGILYPGDRLPPERELT
SRLGVSRATLREAIGRLAAFGVLETRRGRGGGTFVTGVHRESEERAALERALAPIKSTLE
ALLDYRNVVEQALARAAAERRTDDDVAAMRSALAAYEDAASAQASRAADRALHEAIARAT
HNPLLERANAELFEGTNLGFDSHPYSPQLHAKARQQHRAIVDAIARRDVIAAGTLTHEHF
LVTGTYPLIDPDEPDHTAARASTA
Download sequence
Identical sequences C7LZU4
WP_015798736.1.72805 gi|256372101|ref|YP_003109925.1| 525909.Afer_1326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]