SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256372600|ref|YP_003110424.1| from Acidimicrobium ferrooxidans DSM 10331

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256372600|ref|YP_003110424.1|
Domain Number 1 Region: 14-262
Classification Level Classification E-value
Superfamily Cgl1923-like 2.88e-60
Family Cgl1923-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|256372600|ref|YP_003110424.1|
Sequence length 284
Comment hypothetical protein Afer_1837 [Acidimicrobium ferrooxidans DSM 10331]
Sequence
MEFAWHRRVRQRRRPAALILALSGWTDAGEAASTAASTLERLAGLVPYAHVDPDELYDFT
AVRPLVEIDERGVHGIQWGTLVLRGPARQRGPAIFSLAGPEPQLRWKALASQIAEVAQGL
AIQHVVTLGALLAGTPHTRPVALVGFSTRPELARKLDLLPSHYEGPTGFLSVAQGVLQSS
GVDVTSIWAEVPHYLAQFPAYPAALALAQATTTALDLDLDPTPELDLLIARTAAEIDQYV
SDDPELVSYVGSLEHSYEIDQRTRRSAERISWEAQQYLRRFNAE
Download sequence
Identical sequences C7M1A3
525909.Afer_1837 gi|256372600|ref|YP_003110424.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]