SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256372755|ref|YP_003110579.1| from Acidimicrobium ferrooxidans DSM 10331

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256372755|ref|YP_003110579.1|
Domain Number 1 Region: 18-92
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000000554
Family GntR-like transcriptional regulators 0.024
Further Details:      
 
Weak hits

Sequence:  gi|256372755|ref|YP_003110579.1|
Domain Number - Region: 109-232
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 0.0549
Family GntR ligand-binding domain-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|256372755|ref|YP_003110579.1|
Sequence length 245
Comment GntR family transcriptional regulator [Acidimicrobium ferrooxidans DSM 10331]
Sequence
MPRAAEHVLTHVPFSSLHETDKVDQVVQRLDHAIAAGLLPTGSRLPPEALLARMLGISLT
TLRAALGILRLRGTITTRRGRQGGSVVTADPEAVRAAAIARLRTLGPSEVRDEGDLHAAI
LTRSATLAAERATDGERLALSLAATMLDELSLMHELQLHLELVALAQSTKLLEVELDCLL
WFGGFLQLRSDTERSAMLASLGSLVAAVAEGTSEEAGRRAQRHAERMTRWVHATLIATTH
EDGQR
Download sequence
Identical sequences C7M2B7
525909.Afer_2004 gi|256372755|ref|YP_003110579.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]