SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256372076|ref|YP_003109900.1| from Acidimicrobium ferrooxidans DSM 10331

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256372076|ref|YP_003109900.1|
Domain Number 1 Region: 68-168
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.0000000418
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|256372076|ref|YP_003109900.1|
Sequence length 252
Comment hypothetical protein Afer_1297 [Acidimicrobium ferrooxidans DSM 10331]
Sequence
MRRGTRTIAIAAVVVLVGGGTALAIGVRSSPPTVPRSRSHPSASTAAARTTQGVAITGAP
TPDHVSTVQDVICSGATCVAVGSSPSGDPLMWWSSDGGATFQPSEATIPADVTLNGVTCQ
EQTCVATGLASAPPPAGTPVAFASTDGGRSFTPTTLPEGAGGDGLACSRSLCVLAELPLG
TGGVGSVLVASHPLGPWTQLYLSFAPAASPTAPTTNILRSSGLAACAEDGPCLVANEVTT
IMALRTSPPCGH
Download sequence
Identical sequences C7LZR9
525909.Afer_1297 WP_015798713.1.72805 gi|256372076|ref|YP_003109900.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]