SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|226360187|ref|YP_002777965.1| from Rhodococcus opacus B4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226360187|ref|YP_002777965.1|
Domain Number 1 Region: 2-78
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.98e-20
Family GntR-like transcriptional regulators 0.012
Further Details:      
 
Domain Number 2 Region: 101-229
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 0.0000000602
Family GntR ligand-binding domain-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|226360187|ref|YP_002777965.1|
Sequence length 245
Comment GntR family transcriptional regulator [Rhodococcus opacus B4]
Sequence
MMFEPIARKSASTEVFDQITARVLGGDLAAGEALPSERRLAEAFGVSRPAVREAIQKLAQ
AGLVEVRQGDATSVRDFRQHGGPELLSQLLIRGGVPDWAVVRSVLEARRMIGVQVARLAA
DRATEKSGTALREAADHLASETDPVAQQVGALAFWERVVDTADSIAFRLIFNSLRNAYEP
TMTAMAAVMVAEVGRADLYHQLAEAISAHDEDLAAQTAATLLDLGTAAVTAVIDTLQHHD
SEKDT
Download sequence
Identical sequences C1AU12
gi|226360187|ref|YP_002777965.1| WP_012688017.1.34288 632772.ROP_07730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]