SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|226360505|ref|YP_002778283.1| from Rhodococcus opacus B4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226360505|ref|YP_002778283.1|
Domain Number 1 Region: 121-205
Classification Level Classification E-value
Superfamily S13-like H2TH domain 4.97e-26
Family Middle domain of MutM-like DNA repair proteins 0.002
Further Details:      
 
Domain Number 2 Region: 2-123
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 2.62e-22
Family N-terminal domain of MutM-like DNA repair proteins 0.0037
Further Details:      
 
Domain Number 3 Region: 227-264
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000011
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|226360505|ref|YP_002778283.1|
Sequence length 265
Comment DNA glycosylase [Rhodococcus opacus B4]
Sequence
MPEGHTLHRLARLHQRRFAGAPVRVLSPQGRFAEDAALVDGRVLVKSEAWGKHLWHHYES
GLVVHVHLGLYGAFTEAAVPMEPPVGQVRMRMVGAEFGTDLRGPTACEVLHPPQVAAIEA
RLGPDPLRKDADPDKAWKRISASKTPIGALLMDQAVIAGVGNVYRAEVLFRHGIDPARPG
RGLSRDEWDALWADLVALMKVGVRRGRMHVVRPEDDHGDPAYAKDRPRTYVYRRAGSPCR
ICGTPVAHAVMKGRNLFWCPSCQPA
Download sequence
Identical sequences C1AVQ8
WP_012688319.1.34288 632772.ROP_10910 gi|226360505|ref|YP_002778283.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]