SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|242280868|ref|YP_002992997.1| from Desulfovibrio salexigens DSM 2638

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|242280868|ref|YP_002992997.1|
Domain Number 1 Region: 17-122
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0000172
Family Di-heme elbow motif 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|242280868|ref|YP_002992997.1|
Sequence length 146
Comment C_GCAxxG_C_C family protein [Desulfovibrio salexigens DSM 2638]
Sequence
MEPRDQAVTALLNGSSCAQAVLEALGNKYGLGADVAKKITAGLGGGLASGLTCGAVSGGC
LALGLALGSDNPADTYSRERTYYAVQELLARFAKINHSHQCSEILSLNDQEIKTPEGKKR
LRESKLCLKLVTDTIDCIEDILNEEL
Download sequence
Identical sequences C6BSK2
526222.Desal_3409 gi|242280868|ref|YP_002992997.1| WP_015853274.1.7152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]