SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257068724|ref|YP_003154979.1| from Brachybacterium faecium DSM 4810

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257068724|ref|YP_003154979.1|
Domain Number 1 Region: 6-265
Classification Level Classification E-value
Superfamily Cgl1923-like 3.66e-64
Family Cgl1923-like 0.0000141
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257068724|ref|YP_003154979.1|
Sequence length 353
Comment hypothetical protein Bfae_15610 [Brachybacterium faecium DSM 4810]
Sequence
MDPTTLFSYERHVDSRALHGRTLLVTLGAYSDAGDAQQLVDDHLLNTLSSRVVGRLDMDQ
VYDYAGRRPEVTLQLDHFADYDKPEILLHEVTALDGETFFLLTGPEPSFQWERVASALRI
VVEQLGIERTLLLQGFPAPVPHTRELPVTRFAGDPDSISVRRTMPGTFRLRAPFTALLTM
RLAEGGHEVVGLTVHVPQYLHEMSYPDAAIALLGAITEEQGPEVPSGTLEAQAQPVREAV
TAQIDAQPQLQEMVADLESRFDRMITSGAGAEVPTADAIAAEVEQYLATFEPGDEKGEAG
AETGEPGTPQPEEAPQSEETPQSEKDGEDREGPAASGGGSAASPSEGPSPSEG
Download sequence
Identical sequences C7MCT2
446465.Bfae_15610 gi|257068724|ref|YP_003154979.1| YP_003154979.1.138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]