SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|251799763|ref|YP_003014494.1| from Paenibacillus sp. JDR-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|251799763|ref|YP_003014494.1|
Domain Number 1 Region: 144-419
Classification Level Classification E-value
Superfamily Subtilisin-like 9.03e-83
Family Subtilases 0.000018
Further Details:      
 
Domain Number 2 Region: 545-642
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000000128
Family Collagen-binding domain 0.0083
Further Details:      
 
Domain Number 3 Region: 667-766
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.000000824
Family Collagen-binding domain 0.016
Further Details:      
 
Weak hits

Sequence:  gi|251799763|ref|YP_003014494.1|
Domain Number - Region: 424-496
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00458
Family Collagen-binding domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|251799763|ref|YP_003014494.1|
Sequence length 959
Comment peptidase S8/S53 subtilisin kexin sedolisin [Paenibacillus sp. JDR-2]
Sequence
MRRDALGSVLKRTLPALLLAGILACGAAMPAAPAGLAPAGAAAAGKAAAGAPAGAKEEPQ
GWLLKWREPAQAHELRGTRVLRRQSSEAAEVWLVQPADSGADASAWAARLQREPGVEYVH
PNERVHILAAEQTAADDPEIGKQTYLKQIGALEAWKTVRTQTDLTIAIVDTGIDLDHPDL
KRNLVPGTNFVQPNKPPDDDNGHGTAVAGVIAAAGNNGLGVSGILWEAKLMPIKALDSQG
DGTERDLGEAILYAVRNGARIVVMSVGLNRYSPYMLDIVNYAESKGVLLVAAAGNDGLTH
GDKAEVKYPAAYPTVLGVSGAKPDNTPDPRSNPGPEIDLAASWNVYTTAMGGRYKREEGT
SMAAPQVAAAAALVWARYPSLEPYQVRELLRQSAKDIGAPGLDDKSGYGLLQVDKAVTMT
AKSDRFEPNGTRASAKPLPAGKQVTALLSGGSDLDWYTLDAPYDGTITLNFEGLPPEGSA
TPAVRLSHYAGDTLKASAETKLGSRVVDFAVKKGKQAFLIQYMNTDMDLKLPYLLTATFS
MAPDSYEPNDKPYEAFTLQPRSQSITGSFHQLADRDWYAVTFTQGGTLSLRVTTNTVRID
PELAVQQAGQALMSYDEEREGEAEQSPVLTVSPGKYYIRVHNAIASEASPTVGTYTLKMD
YVPKYVDPNEPNDKYYEALMTTSGTEYVGVIGSASDVDWFQIRLASTSVVDLNLFNVPAG
KMMKLEAYDKKQKLVFTQLTGRSGSLQAANKVLQPGVYYIKLTANGAFDKQYYRFKVKFD
PLVAGFRDIGSHWSRDAVVEMSQLGIVSGTGPYTFEPNRPITRAEAVAMAIKAYKPVVYG
MPSDVRFKDLDYDHWAYEAIAKAVQKGWIKGFPDGTFRPEQPVTRAEMAMIIGYADQVRP
VAPLGNPFKDVGRNHWAAPMLNALKLKGVISGTEDNVYEPGKKASRAEFTTILYRVYRH
Download sequence
Identical sequences C6D5D1
324057.Pjdr2_5802 WP_015847344.1.29859 gi|251799763|ref|YP_003014494.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]