SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trici1|168629|fgenesh1_kg.5_#_143_#_Locus1321v1rpkm118.39 from Trichoderma citrinoviride v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trici1|168629|fgenesh1_kg.5_#_143_#_Locus1321v1rpkm118.39
Domain Number 1 Region: 215-643,676-752
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 3.36e-196
Family R1 subunit of ribonucleotide reductase, C-terminal domain 0.00000117
Further Details:      
 
Domain Number 2 Region: 6-214
Classification Level Classification E-value
Superfamily R1 subunit of ribonucleotide reductase, N-terminal domain 1.22e-69
Family R1 subunit of ribonucleotide reductase, N-terminal domain 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Trici1|168629|fgenesh1_kg.5_#_143_#_Locus1321v1rpkm118.39
Sequence length 902
Sequence
MYVRKRDGRQERVQFDKITARVSRLCYGLDTEHVDPVAITQKVISGVYGGVTTVQLDDLA
AETAAYMTVTHPDYAILAARIAVSNLHKQTKKQWSAVVSDLYHYVNPKNNRASPMISKDT
YECVMRHKEELDSAIVYDRDFNYQYFGFKTLERSYLLKLDGKIVERPQHMIMRVAVGIWG
DDIERVLETYHLMSSKFFTHASPTLFNAGTPQAQLSSCFLVDMKDDSIEGIYDTLKTCAM
ISKMAGGIGLNVHRIRATGSYIAGTNGTSNGIIPMLRVFNNTARYVDQGGNKRPGAFAIY
LEPWHADVFDFLDLRKNHGKEEVRARDLFLALWIPDLFMKRVEKNLDWTLMCPNECPGLA
DCYGEEFEALYEKYEREGRGRKTIRAQKLWYSILEAQTETGNPFMLYKDHCNRKSNQKNL
GTIRSSNLCTEIIEYCAPDEVAVCNLASLALPAFVDYNEGCYDFKKLHEVTKVVVRNLNR
IIDVNHYPVQEARNSNMRHRPIGVGVQGLADAFLALRLPFESPEARELNKQIFETIYHAA
LEASMEIAKVEGPYESFKGSPASEGILQYDMWDVKPSDLWEWDSLKEQIKEHGVRNSLLV
APMPTASTSQILGNNECFEPYTSNIYQRRVLAGEFQVVNPWLLKDLVDTGLWSDAMKNRI
IAENGSIQNIPNIPEDIKALYKTVWEISQRQIVQMAADRGAFIDQSQSLNIHMKDPTMGK
ITSMHFTGWKLGLKTGMYYLRTQAAAAPIQFTVDQQALKVADTAVSKDRVLKKRAPPPGS
SFMMTSPSAVPRPSSAKREESTANSLSSNGVPTPTTTPPPSSRPLASPHKAPPMKADIDE
GDSPKVLPTEPSDNVKDEELEKKPNQSEDKDEDSEERERDIYSDAVLACSIENPEACVMC
SG
Download sequence
Identical sequences jgi|Trici1|168629|fgenesh1_kg.5_#_143_#_Locus1321v1rpkm118.39

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]