SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trici1|139036|MIX1199_1029_10 from Trichoderma citrinoviride v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trici1|139036|MIX1199_1029_10
Domain Number 1 Region: 209-316
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.16e-32
Family PDI-like 0.034
Further Details:      
 
Domain Number 2 Region: 42-165
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.19e-19
Family PDI-like 0.018
Further Details:      
 
Domain Number 3 Region: 324-431
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000503
Family PDI-like 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Trici1|139036|MIX1199_1029_10
Sequence length 673
Sequence
MRLTSFSFLSGLAALGLLAFPALAEDEAENVVKPTYFDSVMVPPLTELTPDNFKEVASNT
KWLFVKHYSPYCHHCISYAPYFQTTYEYYYTSKPEGAGDKSFTDFYDFKFAAVNCIAYSD
LCVENGVKLYPTTILYENGKEVKSVTGGQNITFLSGIIEEALEKSKPGSRPRSLALPLPG
EKESPESEPETALKSGTEGKKPKKPVATPNEDGVSVSLTAENFQRLVTMTQDPWFIKFYA
PWCPHCQDMAPTWEQLAKSMKGKLNIGEVNCDKESRLCKDVGARAFPTILFFKGGERSEY
EGLRGLGDFIQYAENAVDLASGVPDVDLAAFKALEQKEDVIFVYFYDHATTSEDFNALER
LPLSLIGHAKLVKTKDPAMYERFKITTWPRFMVSREGRPTYYPPLTPNAMRDTHQVLDWM
RSVWLPLVPELLVTNARQIMEGKIVVLGVLNRDDQESFQGALREMKSAANEWMDRQIQEF
QLERKKLRDAKQMRIEEAEDRDDQRALRAAKAIHVDMSNSGRREVAFAWVDGVAWQRWIR
TTYGIDVKDGERVIINDQDNRKYWDSTVTGNYILVSRTSILETLDKVVYTPQALKPKLTI
SSFEKIFFDIRVSFTEHPYLTLGCIVGIAFGVFSWLRGRSRRGRGHFRLEDSISIRDFKE
GFLGGSNGNTKAD
Download sequence
Identical sequences jgi|Trici1|139036|MIX1199_1029_10

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]