SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trici1|6752|gm1.6752_g from Trichoderma citrinoviride v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trici1|6752|gm1.6752_g
Domain Number 1 Region: 14-81
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 5.54e-20
Family Sm motif of small nuclear ribonucleoproteins, SNRNP 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Trici1|6752|gm1.6752_g
Sequence length 83
Sequence
MENGGISQAEGKDPSSFLSDIIGNSVVVKLNSGVVYKGELQSVDGYMNIALEKTAEYVNG
VKRREYGDTFVRGNNVMYISADS
Download sequence
Identical sequences A0A024SL88 A0A0G0A024 A0A1T3CDS4 A0A2H2ZT63 G9NA13
jgi|Trici1|6752|gm1.6752_g XP_013950976.1.71794 jgi|Triha1|490999|fgenesh1_pm.2_#_920 jgi|Trilo1|45871|e_gw1.1.433.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]