SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|253987666|ref|YP_003039022.1| from Photorhabdus asymbiotica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|253987666|ref|YP_003039022.1|
Domain Number 1 Region: 5-196
Classification Level Classification E-value
Superfamily HAD-like 2.86e-41
Family YihX-like 0.000000666
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|253987666|ref|YP_003039022.1|
Sequence length 203
Comment conserved hypothetical protein [Photorhabdus asymbiotica]
Sequence
MVMLYILDMGNVIIDIDFKRVLAVWSNLSGTPLATLTKSFSMGEMFEKHERGQITDLEFA
DTLCQEMSISLSFEQFTAGWQAIFIDIRPEVIQIMEKLREAGHRVVVLSNTNRLHQDYWP
HNYPEIAASADYLYLSQDLAMRKPEPDIFKYVLEKEGFSPDQAVFFDDVLENVEAASALG
IKGIHVVDRQTVPDYFKEIGFSE
Download sequence
Identical sequences B6VM13
291112.PAU_00183 gi|253987666|ref|YP_003039022.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]