SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|251792459|ref|YP_003007185.1| from Aggregatibacter aphrophilus NJ8700

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|251792459|ref|YP_003007185.1|
Domain Number 1 Region: 3-208
Classification Level Classification E-value
Superfamily CAC2185-like 1.7e-83
Family CAC2185-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|251792459|ref|YP_003007185.1|
Sequence length 209
Comment bicyclomycin/multidrug efflux system [Aggregatibacter aphrophilus NJ8700]
Sequence
MSLFSKIKRAVNKFHRKSINQELKNRLTNHNMSVLSSNCVGAFILHDLNEPFNSPFVNLY
VKPRDFIRYLQNMVHYDRQTLVFEPTDKPYPVGILGDIPIHFMHYHSAQEAQEKWETRLK
RLNLDNLFIIMTDKDGAVGVTYEDLVAFDNLPFKNKVVFTNKPYPELASAFYIKGFEQET
QVGDLFDFSGWNGAKYYDQFDYVAWFNQP
Download sequence
Identical sequences A0A0N2CXX5
634176.NT05HA_0701 WP_005700392.1.19963 WP_005700392.1.60119 WP_005700392.1.9014 gi|251792459|ref|YP_003007185.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]