SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|238916501|ref|YP_002930018.1| from Eubacterium eligens ATCC 27750

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|238916501|ref|YP_002930018.1|
Domain Number 1 Region: 625-686
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000000000245
Family Type I dockerin domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|238916501|ref|YP_002930018.1|
Sequence length 691
Comment glycoside hydrolase family 73 protein [Eubacterium eligens ATCC 27750]
Sequence
MKSVYKCSVKRIAALAVMVCMLVLAGLAFTSVVNTKAESVIAQGHVNYDVTNLRIRKSPV
TGEIITTVDGGFKFDIYEEVNTDSGTVWYSIGFSYDGSYTRGYVTSSYTTIDKRIDYKPD
ADFEEYLNSQGFPDSYKDSLRQLHAQYPNWVFVADHNGKDWSDVVDNQNVIGRSLIHGSA
VSSWKSVADGCYDWESGEYTGLDGSWVQASSALVEYALDPRNFLNATNIFMFENLAFDGS
VQDADGLESMTDGTFMDNSSHDLSYNGRSYTYITGLLYAGQESGVSPYHLTSRILQEQGY
DGHGSSISGTQSGYSGYYNYYNIGASPSGGYTAVQNGLRYASKSDSSLLRPWNTRMKSII
GGAIFIGKSYINKGQDTLYYEKFDMTGRGHQYMTNILAPRSESVKSAQGYSDSNKESISF
VFKIPVYENMPENVCAIPTGDGSPNNRLKNLYVDGWSLTPTFSLYTTEYSFIVDYETSSV
NIGGSALDSSANVSGLGKYELSVGSNDIKITVTAANGDTQDYTITVVRQDKAPDPTPDPE
PDKPDNSVSYPGFSTNLSVDESTKYISGISVSSSVSDVLDKIKNQEGAYSKVLNKNGNEK
DGTVGTGDILITYNSSGNEVSRYEIIIYGDANGDGDIDLFDFALIKRALLGISEPSGIYW
KAADCNKDGELDLFDFAVVKRYILGIGNISQ
Download sequence
Identical sequences C4Z487
WP_012738807.1.74791 515620.EUBELI_00558 gi|238916501|ref|YP_002930018.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]