SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256810886|ref|YP_003128255.1| from Methanocaldococcus fervens AG86

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256810886|ref|YP_003128255.1|
Domain Number 1 Region: 6-253
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 1.33e-126
Family Methyl-coenzyme M reductase gamma chain 0.0000000124
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|256810886|ref|YP_003128255.1|
Sequence length 260
Comment methyl-coenzyme M reductase subunit gamma [Methanocaldococcus fervens AG86]
Sequence
MAYKPQFYPGQTKIAQNRRDHMNPDVQLEKLRDIPDDDVVKIMGHRQPGEDYKTVHPPLE
EMDLPEDYVRDLVEPINGAKEGHRIRYIQFADSMYFAPAQPYDRARTYMWRFRGVDTGTL
SGRQVIEMRESDLEALSKNFLLDTAFFDPARVGIRGATVHGHSLRLDENGLMFDALQRYV
YDEKTGHVVYVKDQVGRPLDEPVDVGEPLPEEKLKEITTIYRIDGVPMREDEELLTVVKR
IHRARTLGGFLPVEDVFEKL
Download sequence
Identical sequences C7P873
573064.Mefer_0937 WP_015791492.1.34365 gi|256810886|ref|YP_003128255.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]