SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257051283|ref|YP_003129116.1| from Halorhabdus utahensis DSM 12940

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257051283|ref|YP_003129116.1|
Domain Number 1 Region: 15-126
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 9.95e-19
Family Heme-binding PAS domain 0.073
Further Details:      
 
Domain Number 2 Region: 138-244
Classification Level Classification E-value
Superfamily SpoIIaa-like 7.65e-17
Family Anti-sigma factor antagonist SpoIIaa 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257051283|ref|YP_003129116.1|
Sequence length 255
Comment PAS/PAC sensor protein [Halorhabdus utahensis DSM 12940]
Sequence
MNEDLIATAIDELEDVFYIFTPEGEFVAWNEQLPAVSGYTDDELDEMEPTALFSGDGSEA
VADAIETVIKNRRRTAVQANLETKSGTEIPYELSVSPLIEDDELRVIVGIGRDITDRLEN
ERRLQRMAEEIRNLSMPVVEIWDGVILTTVVGSLDTAKAERLTEELLDRIVEAEASVALI
DITGVAAIDTATAQHLIDTINAVNLLGARVVITGISPDIAQTLVQLGVELDDVETRSSLM
DGLQVALSWQGVTFE
Download sequence
Identical sequences C7NPT6
519442.Huta_0195 WP_012795260.1.40337 gi|257051283|ref|YP_003129116.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]