SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257051389|ref|YP_003129222.1| from Halorhabdus utahensis DSM 12940

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257051389|ref|YP_003129222.1|
Domain Number 1 Region: 62-388
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.84e-34
Family beta-glycanases 0.0006
Further Details:      
 
Weak hits

Sequence:  gi|257051389|ref|YP_003129222.1|
Domain Number - Region: 431-480
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000109
Family Type I dockerin domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257051389|ref|YP_003129222.1|
Sequence length 481
Comment glycoside hydrolase family 5 [Halorhabdus utahensis DSM 12940]
Sequence
MIDEEKTRNAEHDDTRSIDRPTGDKHTLSTPSRRRFLQATAGTGIAVASGGLVGHAAADS
HTSALPPLRRNGNQIETPDGETIELHGVNIADPKRVDVTASVRGKDAAQAIDLATDPSQG
WHADVVRLPVQPVDIGEHQAGAGPEPPAFDESQLQDYIENHLDPAVQQCAANGAYAIIDY
HRHRDIPWTDDGLSQEVTMFWDIVAQRYGEMDHVIFEVYNEPQGNPNYGVSGQELVDFWG
EWKATAQPWVDTVREYTENLVLVGSPRWSQMTFGAVIEEFDGANIGYTLHLYPGHGPTTP
GDYDDFVTPVNNGGGDVPYDDETPAWEVAPVFMTEWGFDYDADPAAGGGVNEDTAAGADW
AEHDSDFGHHVTEWLSTRPVHSTAWVFDVLWDPNMFTRGFDVPDDEGWAPYTGGEIPEYV
TDRPAEWVLQTGDGEADIDDVRWLLNNRDSEAVKTNPDAYDFDGDGTVGVGDILALFRSI
Y
Download sequence
Identical sequences C7NQN0
WP_012795366.1.40337 519442.Huta_0302 gi|257051389|ref|YP_003129222.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]