SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257052071|ref|YP_003129904.1| from Halorhabdus utahensis DSM 12940

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257052071|ref|YP_003129904.1|
Domain Number 1 Region: 480-824
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.12e-58
Family beta-glycanases 0.0004
Further Details:      
 
Domain Number 2 Region: 920-974
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000131
Family Type I dockerin domain 0.0052
Further Details:      
 
Weak hits

Sequence:  gi|257052071|ref|YP_003129904.1|
Domain Number - Region: 318-429
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00412
Family CBM4/9 0.036
Further Details:      
 
Domain Number - Region: 826-865
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0235
Family Carboxypeptidase regulatory domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257052071|ref|YP_003129904.1|
Sequence length 975
Comment glycoside hydrolase family 10 [Halorhabdus utahensis DSM 12940]
Sequence
MTDDRLHVHGDRRTFLKSVGALGAATAVGSGTIGSVAADGHLDEYHQTLQSELQEQYDLP
AGSFLFGATEQATIDSFEFQSGDSGNLSEISIDNDSVPITQGVQIEVNEEGADSWSYSYQ
RFLTEQDFAQGDVLLGVAYLRSESDNAETEGFFKYRYKDAEGDDWSYQNANYITDNSAVQ
PGSEWTRYYFPIEVGSRPGSIRDAYVEFWLGMAQQTVEFGGMALIDYSDADVGIGNLPSG
EAVPPEESSGYQIWTDTDDPYYSDLVSDLKGYNLGGAGKFAYGTTEAATFDAYEVAGGSS
DLANQESIDVGDDVPFSEATRIEVTEQADDDWLVNLKAYGDRALESGDALLGVAYMRAPE
GDTSITYKMTSSGDESANYVTKPRPPLTGEWKRFYFPIEAGSAAASGEWWTEIWLGAQAQ
TVDIGGLAVVDFAKGVSVGDLPAWEQEINEEWEDEADARIEEHRKTDVAVEVVDGDGSAV
EGADVEVAMQEHDFSFGTEVTADHLIQNTEPGDQYRQVITENFNTAVLGNHHKWRFFEEA
QDIADSATEWLVEQNMRIRGHVCLWAAVDSYAVPEDVVAAMGREWSEVENPELDPEYVRD
RTMSHIEEIINHYADFQDYGSVIDEWEVHNETTHVPGFIKAVRGVGPDEELDINAVEAPV
LAEWHNHAEDVAPDDVGIAINDYNTIEGPYQSTRDNHKRMAEFLIENDVDLDGIGLQSHF
SQSSALTPSEIWEALEFYSGLGAGIRITEFDMADDTWMEADKATFFKQFLKITFSHPNAE
TFMVWGFQDSLHWRDDAPFFDSQWNPKPALDVWQNLIFDEWWTEESGSTDADGMFATDAF
KGTYHITATHGEETVEREVEISDDTDTLTMTVGEGDGEQDDGEADDGETDDGEDDGEETP
PGALPGGKGAPQDLDGDGLHEDVNGDGNANIADVRSLLNNRNNEMVQSNADAYDFTGDGK
VGVSDVLELFRKLYR
Download sequence
Identical sequences C7NV87
WP_015788748.1.40337 519442.Huta_0988 gi|257052071|ref|YP_003129904.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]