SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257052490|ref|YP_003130323.1| from Halorhabdus utahensis DSM 12940

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|257052490|ref|YP_003130323.1|
Domain Number - Region: 87-131
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0255
Family Sfri0576-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257052490|ref|YP_003130323.1|
Sequence length 133
Comment hypothetical protein Huta_1414 [Halorhabdus utahensis DSM 12940]
Sequence
MSVETLRDEDTHTIEYDDELNALIHTWNTFSSGETFREGANELLSVFTERDVSKLIIDTT
EVKAHDEEDKQWLQEVWLPNMIDVGLAASVNVHRESVIAEMDMQETVDPLEDEPFENFMT
DDMDEAREWLAEQ
Download sequence
Identical sequences C7NNR5
519442.Huta_1414 gi|257052490|ref|YP_003130323.1| WP_015789164.1.40337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]