SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257052633|ref|YP_003130466.1| from Halorhabdus utahensis DSM 12940

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257052633|ref|YP_003130466.1|
Domain Number 1 Region: 6-131
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.1e-34
Family YigZ N-terminal domain-like 0.00019
Further Details:      
 
Domain Number 2 Region: 137-201
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 0.0000000345
Family YigZ C-terminal domain-like 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257052633|ref|YP_003130466.1|
Sequence length 203
Comment hypothetical protein Huta_1558 [Halorhabdus utahensis DSM 12940]
Sequence
MTDERYRTVAGPGESQFTISGSQFLGHARPAETVEAAEAFVEEVRAEYDDATHNVPAYRV
RADPLRAWASDDGEPSGSAGKPALNVLAGQELENVVVVVTRYFGGTELGVGGLVSAYSRA
VKEATEDAGVREERPHERLAITVEYDDSGTVRSILESEGVDFEASYEARVQFIVRVPTAE
SDTLRDRIASATSGRAMVETPEA
Download sequence
Identical sequences C7NPE6
gi|257052633|ref|YP_003130466.1| WP_015789307.1.40337 519442.Huta_1558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]