SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257052933|ref|YP_003130766.1| from Halorhabdus utahensis DSM 12940

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257052933|ref|YP_003130766.1|
Domain Number 1 Region: 128-210
Classification Level Classification E-value
Superfamily Starch-binding domain-like 3.33e-19
Family Rhamnogalacturonase B, RhgB, middle domain 0.0098
Further Details:      
 
Domain Number 2 Region: 356-406
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000157
Family Type I dockerin domain 0.005
Further Details:      
 
Weak hits

Sequence:  gi|257052933|ref|YP_003130766.1|
Domain Number - Region: 45-140
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 0.0293
Family Cellulose-binding domain family III 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257052933|ref|YP_003130766.1|
Sequence length 409
Comment hypothetical protein Huta_1863 [Halorhabdus utahensis DSM 12940]
Sequence
MNDKLKALTLSVVVLFSVISGGAGFVAAQSNAGNAAGNVSVTDYSVGNTTVDVGESVSVT
ATVENVGSSAANATVAFIVDNQTAETRNVSVGANATTNTTFQTSFGTPGPHTVAVNDLAP
TTITVQTPPPQNGTITGTVVDDDTGLPIENATVAVGGPDVSATTDANGTYTLSGLLPGPY
NVVASAEEYKPTFTTAVVRPDNTTTLDLELDELVEQTSNEAELLLDGAPNGLQSYNVTIN
IADEASGTHDQLRAHLLPPDTVQVLERTNTTLSFRVADLGETIGSFEEQRKLTSFEFTGP
VEADELSLEIHGLVDDNGDPINQSRLSLELDLLFENPLPGAAADDPPLDPDDDGLFEDID
GDGEVDFTDAISLAFVDYDALSAEQQAALDFDGDGEVTFADAIELAFQV
Download sequence
Identical sequences C7NSE6
gi|257052933|ref|YP_003130766.1| 519442.Huta_1863 WP_015789605.1.40337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]