SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257053113|ref|YP_003130946.1| from Halorhabdus utahensis DSM 12940

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257053113|ref|YP_003130946.1|
Domain Number 1 Region: 1-182
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.17e-40
Family GHMP Kinase, N-terminal domain 0.00034
Further Details:      
 
Domain Number 2 Region: 188-307
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 5.35e-30
Family Mevalonate kinase 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257053113|ref|YP_003130946.1|
Sequence length 330
Comment mevalonate kinase [Halorhabdus utahensis DSM 12940]
Sequence
MVTSSAPGKVYLFGEHAVVYGEPAVPCAIERRASVTATRRDDEALRVDAGDLTLDGFTVE
YSGGTDGRPDVDVEQPLLEAAMGYVNEAVEQARDATGRPEAGFDVHIDSAIPLGAGLGSS
AAVVVAAIDAATRELGVTLDSEEIADRAYQVEHAVQDGEASRADTFCSAMGGAVRVEGDD
CRRLEAVPNLPFVIGYDGGSGDTGALVSGVRGLRAEYDFAADTVEAIGDVVRRGEDALAA
ADLDELGRLMDFNHGLLSALGVSSRSLDAMVWAARDADARGAKLTGAGGGGCIVALDDTD
GTETALRYTPGCEDAFRAELDTEGVRVEER
Download sequence
Identical sequences C7NTM3
519442.Huta_2045 WP_015789784.1.40337 gi|257053113|ref|YP_003130946.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]