SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257053191|ref|YP_003131024.1| from Halorhabdus utahensis DSM 12940

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257053191|ref|YP_003131024.1|
Domain Number 1 Region: 4-88
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.52e-33
Family Imidazole glycerol phosphate dehydratase 0.00018
Further Details:      
 
Domain Number 2 Region: 89-180
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.78e-29
Family Imidazole glycerol phosphate dehydratase 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257053191|ref|YP_003131024.1|
Sequence length 195
Comment imidazoleglycerol-phosphate dehydratase [Halorhabdus utahensis DSM 12940]
Sequence
MTDRTAAVTRETGETDIEVTLDLDGDGESTIETGIGFFDHMLDAFATHGLFDLTVRCDGD
LAVDDHHTVEDVAITLGEAVTEALGEKRGIDRFADRRVPLDEAVATVVVDVSGRPYFEFG
GEFSQATVGEFTSVMAKHFLRSLAMNAGLTLHASVEGENAHHEVEALFKGLARALDDATR
IDDRRADAPSTKGEL
Download sequence
Identical sequences C7NU46
gi|257053191|ref|YP_003131024.1| 519442.Huta_2124 WP_015789862.1.40337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]