SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257053489|ref|YP_003131322.1| from Halorhabdus utahensis DSM 12940

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257053489|ref|YP_003131322.1|
Domain Number 1 Region: 45-358
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 2e-70
Family alpha-L-arabinanase-like 0.0000463
Further Details:      
 
Domain Number 2 Region: 644-698
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000883
Family Type I dockerin domain 0.0034
Further Details:      
 
Weak hits

Sequence:  gi|257053489|ref|YP_003131322.1|
Domain Number - Region: 452-569
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00706
Family CBM4/9 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257053489|ref|YP_003131322.1|
Sequence length 699
Comment glycoside hydrolase family 43 [Halorhabdus utahensis DSM 12940]
Sequence
MTAGDDTHSLNRRHVLKSIGVGALGTTGILGTSGSAIADNGGTHYSNPLYGPDFADPTIH
RAEDGTWWAYASNMSYIEDSDERLIPILSSPDLVNWTYEGEAFDSRPGWLYGSIWAPDVH
YHDGQWVLFYALWPRGDDDSQVPGIGVATSETPDGPFTDHGEILSNPDHPYPGNTIDPYF
AYHNGTPYLFWANFAGINVVELTEDLQDYQPGTFNQIAGSAYEGPAIFQRGDYWYVFGST
GDCCDGFDSTYEVEVGRSENLLGPYHDRDGTPMLERDEWNAGPTHLGDNDRFVGPGHGDV
TVDDDGTYWFVYHAYDTEGPEFVDNGWPPARQLFVDPIQWEDGWPIIGCDGTPSSEMAVP
GEGGYCSGGDDGTGDGGGVGDDVGDGTGDGYETWTDTDDPYYATLVSDLTGYDLPSAGQF
VNGTDESVVWDTYEIDGGNADRLERSSLAVGDEVPFSEAARFSVTDPPENPWGITLKSFG
ERELERGQVLLGVAYMRTPGEEASVTYKSTASTNTPDNYVTGAQPPLGAEWQRYYFPIEF
GVSAAPGEWWTEIWLGAAAQTVDIGGLAVIDFAEGVRAHDLPVRAETGETAVGTDGDTDT
ETDTSGESEGEQDDSEAGGSEGTPAGGLPGGEGPSQDLDGDGLHEDVNGDGTVDVSDVRS
LLTNVNSEVVQKNADAYDFDGDGGVDVGDVLALYRRIYQ
Download sequence
Identical sequences C7NMF0
WP_015790155.1.40337 gi|257053489|ref|YP_003131322.1| 519442.Huta_2423

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]