SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257053946|ref|YP_003131779.1| from Halorhabdus utahensis DSM 12940

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257053946|ref|YP_003131779.1|
Domain Number 1 Region: 6-123
Classification Level Classification E-value
Superfamily CheY-like 3.7e-29
Family CheY-related 0.0021
Further Details:      
 
Weak hits

Sequence:  gi|257053946|ref|YP_003131779.1|
Domain Number - Region: 127-182
Classification Level Classification E-value
Superfamily PspA lactotransferrin-binding region 0.0915
Family PspA lactotransferrin-binding region 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257053946|ref|YP_003131779.1|
Sequence length 194
Comment response regulator receiver protein [Halorhabdus utahensis DSM 12940]
Sequence
MSGSEPPVVLIVEDEPDVAETYNLWLQDEYEVRMAESGSEALEMLDESVDVVLLDRMMPG
LSGDEVLERIRGSESSCRVAMVTAVEPDFDILEMGFDSYLTKPIRSDELHDTVSNLLERS
TYDGLLQEYYSLVEKQATLEATKSHAELAESDEYQQLSTRVDDLNDELSETLGGVEDDED
FIATLRELSNGDEH
Download sequence
Identical sequences C7NRU1
gi|257053946|ref|YP_003131779.1| 519442.Huta_2885 WP_015790608.1.40337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]