SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257054086|ref|YP_003131919.1| from Halorhabdus utahensis DSM 12940

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257054086|ref|YP_003131919.1|
Domain Number 1 Region: 8-159
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.59e-19
Family GHMP Kinase, N-terminal domain 0.0064
Further Details:      
 
Weak hits

Sequence:  gi|257054086|ref|YP_003131919.1|
Domain Number - Region: 234-265
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 0.00396
Family Homoserine kinase 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257054086|ref|YP_003131919.1|
Sequence length 283
Comment shikimate kinase [Halorhabdus utahensis DSM 12940]
Sequence
MEGTAVAPAAGTVLNALATGTGSAFAIDAELRAEVTLEADGGVSGTIAGEPDADTALIEH
CVELVTERFGDGEGGSVRTESDIPLAAGLKSSSAAANATVLATLSALDADSAVSRVDAAR
IGVQAARDAGVTATGAFDDASASMLGGVTVTNNHEDELLARETVEWDVLVWTPPERAYSA
EADIERCQQVAPMAELVADLALDGAYERAMTVNGLAFTAALGFSAEPLLEAMPHVAGVSL
SGTGPSVTAVGNRDDLERVRAIWEQREGTTWLTTTQTDGTRTR
Download sequence
Identical sequences C7NT75
gi|257054086|ref|YP_003131919.1| WP_015790748.1.40337 519442.Huta_3025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]