SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|229585265|ref|YP_002843767.1| from Sulfolobus islandicus M.16.27

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229585265|ref|YP_002843767.1|
Domain Number 1 Region: 3-44,123-338
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.42e-47
Family NOL1/NOP2/sun 0.00081
Further Details:      
 
Domain Number 2 Region: 69-127
Classification Level Classification E-value
Superfamily PUA domain-like 0.0000112
Family PUA domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|229585265|ref|YP_002843767.1|
Sequence length 339
Comment Fmu (Sun) domain-containing protein [Sulfolobus islandicus M.16.27]
Sequence
MKEVYGEYLNDFLDAIRKPNPRLYVRVNTLKTSVESILENLPHFKLDEDFKEAIYTEIKG
PNEINIRQNKVIVDKKTAESVMLGANVYKPGLKRVVINDPKDKMVTVYSDREIPVAEGKY
YGTNTDLIVEVTNSLYTSPKLADLSELKNGLIYVQGKASMYVAHLLDPQPNEKIVDMTAY
AGGKLTHIYQLEPRVKLIGFDHTEKKVEKLRDLVNKMGMRIEIYKADSRYLYEDYNIRDV
DKVIIDPPCSALGIRPKLYDKKTEQDILNFHKYQKQFLNSAYKILKKNGVVIYSTCTVTT
WENEKVINDPRFSVEYEIRFHPHIHEITGFFIAKLIKKG
Download sequence
Identical sequences C3MXE4 C3MZ90 C4KIG8
gi|238620224|ref|YP_002915050.1| gi|227827996|ref|YP_002829776.1| WP_012711709.1.100559 WP_012711709.1.27461 WP_012711709.1.44962 WP_012711709.1.47130 WP_012711709.1.48461 WP_012711709.1.60638 WP_012711709.1.68242 WP_012711709.1.74483 WP_012711709.1.83431 WP_012711709.1.84481 WP_012711709.1.90709 WP_012711709.1.97021 426118.M164_1779 427317.M1425_1732 427318.M1627_1850 gi|229585265|ref|YP_002843767.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]