SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|229585613|ref|YP_002844115.1| from Sulfolobus islandicus M.16.27

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229585613|ref|YP_002844115.1|
Domain Number 1 Region: 2-65
Classification Level Classification E-value
Superfamily Pre-PUA domain 6.47e-22
Family Hypothetical protein Ta1423, N-terminal domain 0.0097
Further Details:      
 
Domain Number 2 Region: 68-150
Classification Level Classification E-value
Superfamily PUA domain-like 4.48e-18
Family PUA domain 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|229585613|ref|YP_002844115.1|
Sequence length 152
Comment RNA-binding protein [Sulfolobus islandicus M.16.27]
Sequence
MQRHVMSSKDAKIFINKIKEKYNIDISNAKLEVGKEKKETWYYVNDILAFFDDLIPTLCA
IMKLKISLPYVIIDEGAVRAVSKGADLFAPGIVEYGCECKENDIILAKTKTNQPVAVLRV
LMSKDKALVEKRGKFAINLHHVGDTIWEMCNG
Download sequence
Identical sequences C3N0R2 C4KJT9
426118.M164_2131 427318.M1627_2207 gi|238620576|ref|YP_002915402.1| gi|229585613|ref|YP_002844115.1| WP_012719046.1.100559 WP_012719046.1.27461 WP_012719046.1.44962 WP_012719046.1.47130 WP_012719046.1.48461 WP_012719046.1.60638 WP_012719046.1.74483 WP_012719046.1.83431 WP_012719046.1.84481 WP_012719046.1.89621 WP_012719046.1.90709 WP_012719046.1.97021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]