SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|224371609|ref|YP_002605773.1| from Desulfobacterium autotrophicum HRM2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|224371609|ref|YP_002605773.1|
Domain Number 1 Region: 316-640
Classification Level Classification E-value
Superfamily Subtilisin-like 1.44e-76
Family Subtilases 0.00000967
Further Details:      
 
Domain Number 2 Region: 72-188
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00000248
Family Collagen-binding domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|224371609|ref|YP_002605773.1|
Sequence length 872
Comment putative protease [Desulfobacterium autotrophicum HRM2]
Sequence
MVKKIHLPGFIQILLLLFFCASCGGGGGGGATEQGAEDGSIVNPSPVAFSVGGKIVISSG
NLMDSDTNDPNSSVKENNTFETAQSISSPSTLGGYVNEPLKGATGTSFVLGDRSDIYVVS
FTGNEIISLSFADSLINDLDLYLYNALFEIVDSSKDVVGIETLKVNVPGTYYIRVYAHSG
ASAYVLTLGNDLVPISNSQMILSQKFMPGEAIVGFKQSTDAADSLSVQETHGGVVPVLLR
LDSPSTYSISSLASQVEEITSDTAALIPGASESLVEKDRTLNLLKALKRREDVDYAEPNF
IRKPSVVTPSDPYYVRQWNYPLINLPNAWGTTTGDSDVIVAVMDTGVLLNHPDMVDRLTP
GYDFISSPANGLDGDGIDDDPDDPGGQGNGTTSSFHGTHVAGTIGAATNNSLGVAGISWN
TMIMPLRVIGRDGGTSYDIVQALRYAAGLENDSGLFLQQRADIINMSFGSTGYSQSEQNI
INTLTGMGTILVAAAGNDSSSQPVYPAAYSGVVAVGAVTLEKKAAWYTNYGSWIDISAPG
GDTSTDINGDGFPDGVLSTGGDDSSESIRFLYTFLQGTSMAVPHVAGVFALMKSIYPGLD
MDTVIDLLEEMRLTDDTGSPGRDDFHGNGLVNAQKCLSAAIELAQGVQTLDPPVLAATPG
AINFGATANTMTLTIANGGDGDLWMDEPVSSLFWLTITRDQTDTANLGTYLVTVDRSLLN
EGTSYSGTITLTSTANTLSIPVTVYQPSQASTGMDLGTHYIQMVNTETDQVFQVVANAEN
GEYPFLFTGLPAGAYRLYAGNDPDNDGYILGSWEAAGGYKTVDAPTLIHVNRDISGIEFF
TGYNFVISADSQALSSNTGRTQETKRVLQSEE
Download sequence
Identical sequences C0QG30
gi|224371609|ref|YP_002605773.1| 177437.HRM2_45530 WP_015906323.1.52472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]