SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|254780212|ref|YP_003064625.1| from Candidatus Liberibacter asiaticus str. psy62

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|254780212|ref|YP_003064625.1|
Domain Number 1 Region: 4-155
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.68e-48
Family Glutathione peroxidase-like 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|254780212|ref|YP_003064625.1|
Sequence length 157
Comment bacterioferritin comigratory protein [Candidatus Liberibacter asiaticus str. psy62]
Sequence
MTSLSVGDKAPHFVLPSNDEQEISLLALGGSKIVLYFYPKDDTSGCTAEAINFSSLKADF
DEESTILIGISPDSIASHKKFHQKHNLSITLLADESKEVLKSYDVWKEKSMFGKKYMGVV
RTTFLIDEKGIIAQIWKPVTLKNHAQSVLKMVKSLKQ
Download sequence
Identical sequences C6XHE2
537021.CLIBASIA_00485 gi|254780212|ref|YP_003064625.1| gi|470204575|ref|YP_007598673.1| WP_012778432.1.15810 WP_012778432.1.15976 WP_012778432.1.16756 WP_012778432.1.18731 WP_012778432.1.3509 WP_012778432.1.50033 WP_012778432.1.77054 WP_012778432.1.78654 WP_012778432.1.79050 WP_012778432.1.94010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]