SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|254780311|ref|YP_003064724.1| from Candidatus Liberibacter asiaticus str. psy62

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|254780311|ref|YP_003064724.1|
Domain Number 1 Region: 21-174
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.61e-32
Family Glutathione peroxidase-like 0.0000251
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|254780311|ref|YP_003064724.1|
Sequence length 177
Comment hypothetical protein CLIBASIA_00980 [Candidatus Liberibacter asiaticus str. psy62]
Sequence
MIRFQIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQL
PGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVY
KDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESKK
Download sequence
Identical sequences C6XHP1
537021.CLIBASIA_00980 gi|470204673|ref|YP_007598771.1| WP_012778530.1.15810 WP_012778530.1.15976 WP_012778530.1.16756 WP_012778530.1.18731 WP_012778530.1.3509 WP_012778530.1.50033 WP_012778530.1.77054 WP_012778530.1.78654 WP_012778530.1.79050 WP_012778530.1.94010 gi|254780311|ref|YP_003064724.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]