SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|254780594|ref|YP_003065007.1| from Candidatus Liberibacter asiaticus str. psy62

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|254780594|ref|YP_003065007.1|
Domain Number 1 Region: 70-221
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 3.06e-24
Family Glutathione S-transferase (GST), C-terminal domain 0.0063
Further Details:      
 
Domain Number 2 Region: 2-103
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000366
Family Glutathione S-transferase (GST), N-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|254780594|ref|YP_003065007.1|
Sequence length 230
Comment glutathione S-transferase domain-containing protein [Candidatus Liberibacter asiaticus str. psy62]
Sequence
MSILYHYPLSSSSRFIRLILSEYEFTTDMIEEFPWGKRREFLELNPSGTLPVYIDEHMQA
LCGVFVISEYLDETYGAIAQKNRLLSTDPLQRAETRRMIEWFMYQMEQDVTRPLAHERVY
KLHMTTEQGGGSPDSKVLRIARNNMREHIKYITWLIKSRSWIAGHHMSYADFAASATISI
LDYLGEIDWDTAPIVKEWYQRMKSRPSFRPLLSERIRGLLPVSHYTNLDF
Download sequence
Identical sequences C6XFB4
WP_015452565.1.15810 WP_015452565.1.15976 WP_015452565.1.18731 WP_015452565.1.3509 WP_015452565.1.50033 WP_015452565.1.77054 WP_015452565.1.78654 WP_015452565.1.79050 WP_015452565.1.94010 537021.CLIBASIA_02405 gi|254780594|ref|YP_003065007.1| gi|470205090|ref|YP_007599188.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]