SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|118581227|ref|YP_902477.1| from Pelobacter propionicus DSM 2379

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118581227|ref|YP_902477.1|
Domain Number 1 Region: 9-288
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 5.04e-42
Family ROO N-terminal domain-like 0.00000132
Further Details:      
 
Domain Number 2 Region: 255-400
Classification Level Classification E-value
Superfamily Flavoproteins 1.7e-34
Family Flavodoxin-related 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|118581227|ref|YP_902477.1|
Sequence length 404
Comment beta-lactamase domain-containing protein [Pelobacter propionicus DSM 2379]
Sequence
MKPVELKKDIYWVGAIDWSVRDFHGYETPRGTSYNNYLIMDEEITLIDTVKYDFSDITIK
QIKNIVDPARIKHIVINHIENDHVTSIDDIMALTPDATIHISARGKKGLDRFFDTSRWKF
NIVKTGDTLKIGKHSLVFIETPMLHWPDSMVSFCPEANILFSQDAFGQHVASSARFDDEF
DECVSPAVLDDAVIDYYANILMPFGKLILEKVGDLQKLGIQPEIIAPDHGVIWRKNPQRV
LDSYVAMATSKADLRALIVYDTMWKSTEIMSNPIADGIRSEGVDCRVLKLRATPMNVVIK
EFWKARGTLFGSPTLNNILYPSVAECLTHLRGLRPTNRLVGAFGSYGWGGGAVKEAYEVF
AKMGLEPFEPGLQFVFKPSVEDEEKCYEFGQNFAKRLKEYHSGF
Download sequence
Identical sequences A1ASU9
WP_011736661.1.31684 338966.Ppro_2821 gi|118581227|ref|YP_902477.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]