SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|118578959|ref|YP_900209.1| from Pelobacter propionicus DSM 2379

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118578959|ref|YP_900209.1|
Domain Number 1 Region: 355-408
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000628
Family alpha-D-mannose-specific plant lectins 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|118578959|ref|YP_900209.1|
Sequence length 505
Comment hypothetical protein Ppro_0520 [Pelobacter propionicus DSM 2379]
Sequence
MRRFTLAISLLLSLCFTLSVFAAQPLRVFVSDMNVVGVQNKDELKATLQTLLASRLNGEN
ITAVASSAEADAVLTGTYVVIGKVFSVDAMAKSANGKTLTRAFVQGESQDELIPAMGKLA
DKLSADLSKLYASGQIASGAPSYAATSTVVRPNKVTQGNSVQSALVRPDQSQEIIRPRDL
ERNYVGGWQSKRLPGAANLLAMGKTLPDGSREVFLAEDRRLSYYHQAENMSLRFATEFGT
TDKIIGLDTIQGSDGKTEVYLTIMHGEEPSSQIWQVGDNRMECVAKDLPYYLRVIGLAGG
PKKVYAQSMGRETEFYGNVSELTRTGSKVTLSNEIVMPRFGNIFTFNQFKDQQGVLYTVV
LHPDGYLVVFDQEQKELWRSNDKFGGSELYYQKDNSENFRITNDKYRWFFMNQRIQVTSR
NEVLVGKNDGFWVLGNARSYKKGAVYCFIWNGSNLDELWHTRDTQNYMPDFYFDEASSEL
LLLQTVQRPGLTTRGTASLAIKKVE
Download sequence
Identical sequences A1ALD1
338966.Ppro_0520 gi|118578959|ref|YP_900209.1| WP_011734465.1.31684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]