SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|118468179|ref|YP_888465.1| from Mycobacterium smegmatis str. MC2 155

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118468179|ref|YP_888465.1|
Domain Number 1 Region: 12-266
Classification Level Classification E-value
Superfamily Cgl1923-like 4.32e-90
Family Cgl1923-like 0.0000602
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|118468179|ref|YP_888465.1|
Sequence length 292
Comment hypothetical protein MSMEG_4186 [Mycobacterium smegmatis str. MC2 155]
Sequence
MTSSYPPVGRPADLPELENAIVVAAFEGWNDAGDAASDALDHLDAIWEAETIVEIDDESY
YDYQVNRPVIRQVDGVTRELVWPSMRISYCRPPGSDRDVVLMHGVEPNMRWRTFCAELLA
IADKLNVQTVVILGALLADTPHTRPVPVSGAAYSAESAKFFGLEETRYEGPTGIAGVFQD
ACVQAGIPAVTFWAAIPHYVSQPPNPKATVALLQRVEDVLDVEVPLADLPQQAEEWEAAV
TEMTAEDEEIAEYVTSLEERGDAEVDLHEVLGKIDGDALAAEFERYLRRRGR
Download sequence
Identical sequences A0QZX7
246196.MSMEG_4186 gi|118468179|ref|YP_888465.1| gi|118468179|ref|YP_888465.1| WP_011729625.1.100356 WP_011729625.1.19768 WP_011729625.1.23286 WP_011729625.1.56412 WP_011729625.1.74845 YP_888465.1.77314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]