SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|118471616|ref|YP_887078.1| from Mycobacterium smegmatis str. MC2 155

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118471616|ref|YP_887078.1|
Domain Number 1 Region: 18-283
Classification Level Classification E-value
Superfamily Cgl1923-like 1.19e-85
Family Cgl1923-like 0.000000559
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|118471616|ref|YP_887078.1|
Sequence length 348
Comment hypothetical protein MSMEG_2746 [Mycobacterium smegmatis str. MC2 155]
Sequence
MADNENPQQRYQPDQSGMYELEFPAPQLSSSDGRGPVLIHALEGFSDAGHAIRLAAEHLK
KSLDTELVASFAIDELLDYRSRRPLMTFKTDHFTAYEEPELNLYALHDTVGTPFLLLAGL
EPDLRWERFITAVRLLAEQLGVRQVIGLGTIPMAVPHTRPVNLTAHSNNKELIAEHTPWV
GEVQVPASVSNLLEFRMAQHGHEVVGFTVHVPHYLAQTAYPPAAEALLAEVARTGSLELP
LAALSEAGAEVYTKINEQVEASPEVAQVVSALERQYDAFIAAQENRSLLARDEDLPSGDE
LGAEFERFLAQQAGEKFKDDKYKDGHGEGFGGRIRGTVTTTDDVPDQG
Download sequence
Identical sequences A0QVZ0 I7G7B0
WP_011728558.1.56412 YP_887078.1.77314 246196.MSMEG_2746 gi|118471616|ref|YP_887078.1| gi|118471616|ref|YP_887078.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]