SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|148265854|ref|YP_001232560.1| from Geobacter uraniireducens Rf4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148265854|ref|YP_001232560.1|
Domain Number 1 Region: 43-123,206-235
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.00000000000333
Family Photosynthetic reaction centre (cytochrome subunit) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|148265854|ref|YP_001232560.1|
Sequence length 237
Comment hypothetical protein Gura_3837 [Geobacter uraniireducens Rf4]
Sequence
MKKLLATLVAVSAVVMAGSAFAASIVGTKHDLSFGNGVAGGYSAGNSGATQVCVYCHTPH
NSAKTKALWNRKGATADTAFATYTSGIMMEGSVADGWFQGSVKGQFSTKSTSLLCMTCHD
GATTMGGATLNNQPYGLSAAQSNVQSAGVGVVITGAANLGTDLTNDHPVNIDYAKAVVTV
NNARPGSLADTTAATGLPFQNGIMECSSCHNVHDNAIAPFLRGSLAGSGLCLKCHIK
Download sequence
Identical sequences A5G869
WP_011940633.1.63777 gi|148265854|ref|YP_001232560.1| 351605.Gura_3837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]