SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|146277741|ref|YP_001167900.1| from Rhodobacter sphaeroides ATCC 17025

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146277741|ref|YP_001167900.1|
Domain Number 1 Region: 9-243
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 2.2e-29
Family Nuclease 0.063
Further Details:      
 
Domain Number 2 Region: 252-412
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.23e-18
Family Polyphosphate kinase C-terminal domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|146277741|ref|YP_001167900.1|
Sequence length 483
Comment phospholipase D/transphosphatidylase [Rhodobacter sphaeroides ATCC 17025]
Sequence
MNQHRPILRSGETCWRIERADRLAVIIDAADYFARVKQAILEARHSVIMVAWDFDARIRL
DPRAPRDQAPDTLGRFLNWVIRHRPELEIRVLKWDLGTVKALGRGSTPLFVLNWLSDKRM
HFRLDGAHPVSSVHHQKIVVIDDVLAFCGGIDMTADRWDTRDHLDTEPRRRRPTTRRHYG
PWHDVTTAVNGPAAAALGEITRNRWEQATGERLEPPPACETRWLDGLEPLLEGAEVGISR
TLPDYGERPGVHEIEKLYLEIIGRAERTLYIESQYFAARRIAEAIAVRLREEDGPEIVIV
NPLTADGWLEETVMGASRAKLLGMIAEADRYDRFRIYHPVTVQGQPIYVHAKVLAMDERL
LKVGSSNLNNRSMGFDTECDLSVEAAAGETGLQERIAALRDDLIAEHLGVPRETFEAVLR
AKGSLIAAIESLRGPGRSLRPFEPPDLGAIGETLIADNEMLDPERVSRFWRGRCGWSRLR
RAT
Download sequence
Identical sequences A4WT81
WP_011908724.1.61369 gi|146277741|ref|YP_001167900.1| 349102.Rsph17025_1702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]